PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.010G137500.1
Common NamePHAVU_010G137500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 347aa    MW: 39088.9 Da    PI: 6.4549
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.010G137500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.65.8e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEde+l+++++ +G g+W+++++  g+ R++k+c++rw +yl
  Phvul.010G137500.1 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                        788*******************************************97 PP

2Myb_DNA-binding46.58.7e-1567109145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         rg+++ +E  l+++++  lG++ W+ Ia++++ gRt++++k++w+
  Phvul.010G137500.1  67 RGSFSHQEAALIIELHSILGNR-WAQIAKHLP-GRTDNEVKNFWN 109
                         899*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-27664IPR009057Homeodomain-like
PROSITE profilePS5129418.315961IPR017930Myb domain
SuperFamilySSF466894.49E-2911108IPR009057Homeodomain-like
SMARTSM007172.0E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-151461IPR001005SANT/Myb domain
CDDcd001675.43E-121761No hitNo description
PROSITE profilePS5129424.7162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2465116IPR009057Homeodomain-like
SMARTSM007171.0E-1466114IPR001005SANT/Myb domain
PfamPF002491.5E-1367110IPR001005SANT/Myb domain
CDDcd001671.67E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGSF SHQEAALIIE LHSILGNRWA QIAKHLPGRT DNEVKNFWNS SIKKKLLSHD  120
AIPPLATFSD FHNPSNSGSM ESFFPFTANP NVILNFHHYT DQLFLPTTPS PLLQAFDHSN  180
DIKLGLNNHN ANFLHIQNPL PETTLPSSNP SSYEDTWPLA CVALHLNPNE ENQITKNETT  240
SDYVLDKFIN PTALQQHEYH LVEPLVPKVS ENIEDYVCSI PFSSAPQEQH EATEKFQGYP  300
QDLTVAVNQL EYIDAFMSLL PSSTTSSSVS STQKVPYPII PSGWEP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-31141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-124AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007135535.10.0hypothetical protein PHAVU_010G137500g
TrEMBLV7APL70.0V7APL7_PHAVU; Uncharacterized protein
STRINGGLYMA07G01050.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30143168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-80myb domain protein 26